DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi4 and Osi14

DIOPT Version :9

Sequence 1:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_649635.1 Gene:Osi14 / 40770 FlyBaseID:FBgn0040279 Length:268 Species:Drosophila melanogaster


Alignment Length:366 Identity:75/366 - (20%)
Similarity:116/366 - (31%) Gaps:133/366 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVASCLLLALGLNMSLAAIHKRSGANSLGVDPEGKPAANPAVSVENTDLLDKLSWKCANNASCLY 69
            |.|||:..|..:.     .::..|.|:|     |:.|......:|:.|:           |:|| 
  Fly    12 LAASCVFAAPSVQ-----DNQVEGDNTL-----GRAARYLGACLESDDM-----------ATCL- 54

  Fly    70 GVANGLMASYRRGETLKLGLFDLVKL---PELDASRKHKWGTGRGLSGFMDFVTE---NAIRVPV 128
             ...|:.|..|...:..:.|...|..   |....||     ||:.:|. .|...|   ||.. ..
  Fly    55 -AVKGITALNRAARSNNIELASGVTFQRDPASPVSR-----TGKSMSE-QDVYAELPQNADE-RT 111

  Fly   129 GPMV-FSVQRAED--DSDYIEVALLKKTSSSTGRLQVNGGGLLGGGGGLGGNGGGGGGLLGGGGG 190
            |.:| .:|..|.|  .:..:|..|..:|:....|....|.|.:                      
  Fly   112 GRLVDLAVSSAADFLSTHNLEFKLPAETTQQVARALDEGRGKI---------------------- 154

  Fly   191 DNGGGGGLLGGRRRHQHQDKKQFQMFIPMYLA--ATTFGWTMVAAKAVGLLTLKALILSKIAFVV 253
                               ||   |..|:.||  |..|....:....:.|||.||:|::|:||.:
  Fly   155 -------------------KK---MLGPVALAIGAKLFAVIPLVLGFLALLTFKAVIVAKLAFFL 197

  Fly   254 AAIVLIKKLMDNASEKMMYQFPEQTPYMMPYGMDYPLHGAEISPEMYPSSLHHLAMAGGGQLPG- 317
            |.:|...:|:.....|.                                        ||....| 
  Fly   198 AILVGGSRLLGGFGNKF----------------------------------------GGNSFAGA 222

  Fly   318 -------HPGHPGLESLSAESHLHSAQVSSDGSNNTQVLAA 351
                   .|...|..|.::.|:.::..:|.|||:..|:..|
  Fly   223 YNSNAWSAPASAGWSSGASSSYPYARSISEDGSDAQQLAYA 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 19/52 (37%)
Osi14NP_649635.1 DUF1676 62..160 CDD:285181 27/148 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.