DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi4 and Osi10b

DIOPT Version :9

Sequence 1:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001368993.1 Gene:Osi10b / 40764 FlyBaseID:FBgn0286977 Length:284 Species:Drosophila melanogaster


Alignment Length:242 Identity:50/242 - (20%)
Similarity:89/242 - (36%) Gaps:67/242 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GANSLGVDPEG-KPAANPAVSVENTDLLDKLSWKCANNA---SCLYGVANGLM-ASYRRGETLKL 87
            |::.|.:..:| :.:||.:.|..:...|.::...|...|   .||...:..|: .:.|...|.: 
  Fly    13 GSSVLSLSHKGNETSANASTSPWSPRSLGRIIAHCMGGADAWQCLGSESEQLLDGATRDNSTWQ- 76

  Fly    88 GLFDLVKL-PELDASRKHKWGTGRGLSG-FMDFVTENAIRVPVGPMVFSVQRAEDDSDYIEVALL 150
             :.|.:.: |::..|:........||.| .::.|...|:|:.: |...::..|.||.        
  Fly    77 -ITDYLSIEPKVGISKPETRRMDMGLPGKLLELVQGRALRLQL-PRQLTISNAIDDF-------- 131

  Fly   151 KKTSSSTGRLQVNGGGLLGGGGGLGGNGGGGGGLLGGGGGDNGGGGGLLGGRRRHQHQDK-KQFQ 214
                                                      |...||..||::   :|| |...
  Fly   132 ------------------------------------------GSELGLDQGRKK---KDKDKNMA 151

  Fly   215 MFIPMYLAATTFGWTMVAAKAVGLLTLKALILSKIAFVVAAIVLIKK 261
            |...|.:.||..  .|...|.: |:...|.|::|||.|::.:..:||
  Fly   152 MMGGMIMMATLA--QMFLGKVI-LIAGSAFIMAKIALVISLLGSLKK 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 15/51 (29%)
Osi10bNP_001368993.1 DUF1676 52..195 CDD:400313 39/201 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.