DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi4 and Osi6

DIOPT Version :9

Sequence 1:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001287192.1 Gene:Osi6 / 40760 FlyBaseID:FBgn0027527 Length:312 Species:Drosophila melanogaster


Alignment Length:205 Identity:54/205 - (26%)
Similarity:75/205 - (36%) Gaps:68/205 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NSLGVDPEGKPAANPAVSVENTDL----LD---------KLSWKCANNA-SCLYGVANGLMASYR 80
            |||.|:      |.|.|.....::    :|         .|::..||.| |....:.:.:.|   
  Fly   109 NSLAVE------AAPTVEARTAEMGNYFMDNAKSFFAERSLNFNFANAARSVARAIPDDIKA--- 164

  Fly    81 RGETLKLGLFDLVKLPELDASRKHK---------WGTGRGLS--------GFMDFVTENAIRVPV 128
                      ||.:|.....:||.|         .|.|..::        |.: |:.:.|:.|.|
  Fly   165 ----------DLRELVVESRTRKKKLLKKFLPILLGVGAKIAVLGVGSIFGLL-FLAKKALVVSV 218

  Fly   129 GPMVFSVQRAEDDSDYIEVALLKKTSSSTGRL--QVNGGGLLGGGGGL-GGNGGGGGGLLGGGGG 190
              :.|.            :||....||..||:  ...|||||||.||| ||...||......||.
  Fly   219 --IAFF------------LALAAGASSGLGRIGGSGGGGGLLGGLGGLFGGKNAGGSSAASTGGW 269

  Fly   191 DNGGGGGLLG 200
            .:|||....|
  Fly   270 SSGGGASSAG 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725
Osi6NP_001287192.1 DUF1676 81..176 CDD:285181 17/85 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.