DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi4 and Osi3

DIOPT Version :9

Sequence 1:NP_001262305.1 Gene:Osi4 / 40758 FlyBaseID:FBgn0037412 Length:395 Species:Drosophila melanogaster
Sequence 2:NP_001262304.1 Gene:Osi3 / 40757 FlyBaseID:FBgn0037411 Length:288 Species:Drosophila melanogaster


Alignment Length:111 Identity:36/111 - (32%)
Similarity:55/111 - (49%) Gaps:17/111 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 MYLAATTFGWTMVAA---KAVGLLTLKALILSKIAFVVAAIVLIKKLMDNASEKMMYQFP-EQTP 279
            |.:||.|   .||.|   |.:.||..||||:||||.::|.|:.:|||:  :|:|.:.:.| ....
  Fly   179 MMMAAKT---GMVGALLLKGLFLLAGKALIVSKIALLLAVIISLKKLL--SSKKTIVEVPSHHDS 238

  Fly   280 YMMPY--GMDYPLHG-AEISPEMYPSSLHHLA-----MAGGGQLPG 317
            |...:  ..|..:.| .::..::....:.|..     ||..||.||
  Fly   239 YSSGWSRAFDGFVEGLVDVPADILAKEVQHQQEQAQNMAYSGQQPG 284

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Osi4NP_001262305.1 DUF1676 <210..261 CDD:311725 20/44 (45%)