Sequence 1: | NP_001262305.1 | Gene: | Osi4 / 40758 | FlyBaseID: | FBgn0037412 | Length: | 395 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_731065.1 | Gene: | Osi16 / 318801 | FlyBaseID: | FBgn0051561 | Length: | 278 | Species: | Drosophila melanogaster |
Alignment Length: | 265 | Identity: | 58/265 - (21%) |
---|---|---|---|
Similarity: | 80/265 - (30%) | Gaps: | 97/265 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 ANSLGVDPEGKPAANP--------AVSVENTDLLDKLSWKC--------------ANNASCLYGV 71
Fly 72 A------------NGLMA----SYRRGETLKLGLFDLVKLPEL------------DAS----RKH 104
Fly 105 KWGTGRGLSGFMDFVTENAIRVPVGPMVFSVQRAEDDSDYIEVALLKKTSSSTGRLQVNGGGLLG 169
Fly 170 -----GGGGL------------------------GGNGGGGGGLLGGGGGDNGGGGGLLGGRRRH 205
Fly 206 QHQDK 210 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Osi4 | NP_001262305.1 | DUF1676 | <210..261 | CDD:311725 | 0/1 (0%) |
Osi16 | NP_731065.1 | DUF1676 | 72..156 | CDD:285181 | 17/83 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR21879 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |