DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi3 and Osi13

DIOPT Version :9

Sequence 1:NP_001262304.1 Gene:Osi3 / 40757 FlyBaseID:FBgn0037411 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster


Alignment Length:66 Identity:25/66 - (37%)
Similarity:39/66 - (59%) Gaps:7/66 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 EGRGK-------MKNMGPLLMMMAAKTGMVGALLLKGLFLLAGKALIVSKIALLLAVIISLKKLL 223
            |||||       ||.:.|||..:|....::..|:||.|..|:..:.::.||||:.:.|::||.:|
  Fly    90 EGRGKHKKQKKLMKMVYPLLAAVAVAKVVLLPLILKWLTALSTSSFVMGKIALVTSGILALKWIL 154

  Fly   224 S 224
            |
  Fly   155 S 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi3NP_001262304.1 DUF1676 68..180 CDD:285181 10/20 (50%)
Osi13NP_649634.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.