DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi3 and Osi6

DIOPT Version :9

Sequence 1:NP_001262304.1 Gene:Osi3 / 40757 FlyBaseID:FBgn0037411 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001287192.1 Gene:Osi6 / 40760 FlyBaseID:FBgn0027527 Length:312 Species:Drosophila melanogaster


Alignment Length:176 Identity:44/176 - (25%)
Similarity:75/176 - (42%) Gaps:22/176 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 CRQEDDRACKMVKMSIVMNHLYLNTRIDLGDRFKVTENGNISMV-PDDPEVNQLLSRSMGSDE-- 112
            |.:.|..:|..:.:......::.|.:|:|        .|.:|:| .::....:.|..|:..:.  
  Fly    61 CLESDSISCLQLTLFRKAKSVFDNPQIEL--------FGGVSLVKSNEGRQGKSLDNSLAVEAAP 117

  Fly   113 --ETFALLMANKLW----KFIRSRSLRYKFSENTDFVINSDPEGSLNLGVSVRPLEALQEGRGK- 170
              |.....|.|...    .|...|||.:.|:.....|..:.|:   ::...:|.|......|.| 
  Fly   118 TVEARTAEMGNYFMDNAKSFFAERSLNFNFANAARSVARAIPD---DIKADLRELVVESRTRKKK 179

  Fly   171 -MKNMGPLLMMMAAKTGMVGALLLKGLFLLAGKALIVSKIALLLAV 215
             :|...|:|:.:.||..::|...:.||..||.|||:||.||..||:
  Fly   180 LLKKFLPILLGVGAKIAVLGVGSIFGLLFLAKKALVVSVIAFFLAL 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi3NP_001262304.1 DUF1676 68..180 CDD:285181 25/122 (20%)
Osi6NP_001287192.1 DUF1676 81..176 CDD:285181 20/105 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.