DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi3 and Osi5

DIOPT Version :9

Sequence 1:NP_001262304.1 Gene:Osi3 / 40757 FlyBaseID:FBgn0037411 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_649624.1 Gene:Osi5 / 40759 FlyBaseID:FBgn0037413 Length:202 Species:Drosophila melanogaster


Alignment Length:253 Identity:56/253 - (22%)
Similarity:98/253 - (38%) Gaps:80/253 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FLLAKLKQNCRQE--------DDRACKMVKMSIVMNHLYLNTRIDLGDRFKVTENGNISMVPDDP 98
            ||.|...:||.|:        .:||.:    :::.|       ::..|:..|...| :.:||   
  Fly    12 FLTAVRSENCDQDAGATLYCRGERALR----NVLRN-------LNRSDKPLVVIRG-LEIVP--- 61

  Fly    99 EVNQLLSRSMGSDEETFALLMANKLWKFIRSRSLRYKFSENTDFVINSDPEGSLNLGVSVRPLEA 163
                |.:.|:..:|......:.:.|..::|:..:..|.::    ::..:.:              
  Fly    62 ----LQNNSISDEEPDQEQGLLDSLSFYLRTHEINVKLAD----LLEDESQ-------------- 104

  Fly   164 LQEGRGKMKNMGPLLMMMAAKTGMVGALLLKGLFLLAGKALIVSKIALLLAVIISLKKLLSSKKT 228
            :.|.|.|.|..|.||.|......|:..:.|.|:..||.|||.||.:||::|.::.|       ||
  Fly   105 VSEARKKDKGQGMLLAMALMFGKMMAVMGLGGIAALAMKALGVSLVALMMAGMLGL-------KT 162

  Fly   229 IVE---VPSHHDSYSSGWSRAFDGFVEGLVDVPADILAKEVQHQQEQAQNMAYSGQQP 283
            ..:   ..||..||.:|                      |..|.:.:.::   |||||
  Fly   163 AAQHGGESSHSISYVTG----------------------EGHHHKRRRRS---SGQQP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi3NP_001262304.1 DUF1676 68..180 CDD:285181 19/111 (17%)
Osi5NP_649624.1 DUF1676 <55..121 CDD:285181 16/91 (18%)
RCR 184..>201 CDD:304939 5/15 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.