DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi3 and Osi16

DIOPT Version :9

Sequence 1:NP_001262304.1 Gene:Osi3 / 40757 FlyBaseID:FBgn0037411 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_731065.1 Gene:Osi16 / 318801 FlyBaseID:FBgn0051561 Length:278 Species:Drosophila melanogaster


Alignment Length:168 Identity:49/168 - (29%)
Similarity:77/168 - (45%) Gaps:41/168 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 ISMVPDD-------PEVNQLLSRSMGSDEET--FALLMANKLWKFIRSRSLRYKFSENTDFVINS 146
            ||:|.|:       .|:...::||..||..|  ...::| ||...:|:|.||::..::       
  Fly    87 ISVVKDENATELKTSELMAEVARSYPSDPSTRLNGYIVA-KLENLLRTRFLRFRLLDD------- 143

  Fly   147 DPEGSLNLGVSVRPLEALQEGR-GKMKNMGPLLMMMAAKTGMVGALLLKGL---FLLAGKALIVS 207
                           ::|.||| .|....|.|..::||...|.|.|:..||   .|:|||||:.:
  Fly   144 ---------------KSLVEGRKHKFGKKGGLEALVAAGVMMKGMLMAMGLGAIALMAGKALMTA 193

  Fly   208 KIALLLAVIISLKKLL--SSKKTIVEV---PSHHDSYS 240
            .:||.|:.::.||.|.  ..|.|..|:   |.:..|:|
  Fly   194 LMALTLSGVLGLKSLAGGGGKSTTYEIVAKPIYTSSHS 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi3NP_001262304.1 DUF1676 68..180 CDD:285181 24/98 (24%)
Osi16NP_731065.1 DUF1676 72..156 CDD:285181 22/91 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.