DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi2 and Osi18

DIOPT Version :9

Sequence 1:NP_001262303.1 Gene:Osi2 / 40756 FlyBaseID:FBgn0037410 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_649639.1 Gene:Osi18 / 40775 FlyBaseID:FBgn0037428 Length:306 Species:Drosophila melanogaster


Alignment Length:309 Identity:74/309 - (23%)
Similarity:121/309 - (39%) Gaps:75/309 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 CLGGDLS-ECFKTQALNTFDEIFFKDQYKLSDFARVVRLPE-TQQRSLLQEPFEYSEEPRGDDDE 153
            || .||| .|.:.:||..|:....:.:.::::...:||..| .:.||:       :.|.|..|| 
  Fly    43 CL-KDLSVSCVRPKALQWFNSALRQPEVRITERLSIVRTAEKVESRSM-------NPEERLFDD- 98

  Fly   154 WNQLLKYGLRRAERFIKSTALEVEWPEELTEAGRYEARFIGNDIDGELDLIDDG---QRAGHFSR 215
                       .:.::.|.:|.::.||....:   |||.:..|......|...|   ..|.:..|
  Fly    99 -----------IDSYLGSHSLRIQAPEYFRTS---EARSLVPDFLMSNPLTQGGLVPLAAANEGR 149

  Fly   216 KKLKKMIIPLLLVLKIFKLKLLLFLPFILGIAGLK----KILGLAAIVLPGLFAYFKLCRP---- 272
            ..::|.::|.||.|   |||..:.:|..||:..||    ..|||.::||.|....||:.:|    
  Fly   150 GMIRKAVLPFLLGL---KLKTTVLVPLALGLIALKTWKAMTLGLLSLVLSGALVIFKIAKPKIVN 211

  Fly   273 ------PGGVGGAFGGGLSGLFGGKNTFPEY----NPQGVGAATYYH--HH-EHFEGGHGGAPGP 324
                  |..|.......:      ::..|.:    .|..:.....:|  || ||....|...|..
  Fly   212 YEVVHYPHHVDHVVPHHI------EHVVPHHIEHVVPHHIEHIVPHHIDHHLEHHIDHHVDLPVE 270

  Fly   325 Y--YRQEPSFAKPYTDYYSKSYQGQQVQGQQVGGNSVSFGDPQEAAYNG 371
            :  :.:.||   |..|.::.:...|:.|            |.|:.||.|
  Fly   271 HIEHLEHPS---PAWDPHAWARSSQEPQ------------DAQDLAYAG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi2NP_001262303.1 DUF1676 108..224 CDD:285181 23/119 (19%)
Osi18NP_649639.1 DUF1676 60..158 CDD:285181 23/119 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.