DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi2 and Osi9

DIOPT Version :9

Sequence 1:NP_001262303.1 Gene:Osi2 / 40756 FlyBaseID:FBgn0037410 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_649628.2 Gene:Osi9 / 40763 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster


Alignment Length:263 Identity:62/263 - (23%)
Similarity:94/263 - (35%) Gaps:86/263 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 CFKTQALNTFDEIFFKDQYKLSDFARVVRLPETQQRSLLQEPFEYSEEPRGDDDEWNQLLKYGLR 163
            |.|.:||:.||.  .....:|::...:|:..|......|.| .:..||....:.|.:.||   :.
  Fly    43 CMKERALHYFDA--ENGDVRLTEGIALVKTDEIPVGRSLNE-MQLPEEVEAREAEVDSLL---VE 101

  Fly   164 RAERFIKSTALEVEWPEELTEAGRYEARFIGNDIDGELDLIDDGQRAGHFSR---KKLKKMIIPL 225
            |..||..:..|:.:.|:                     |.|.|.|||...||   |:.||.::||
  Fly   102 RVARFFGTHTLQFKVPK---------------------DSIQDMQRALEESRGKKKEKKKYLMPL 145

  Fly   226 LLVLKIFKLKLLLFLPFILGIAGL----KKILGLAAIVLPGLFAYFKLCRPPGGVGGAFGGGLSG 286
            |:   :||||:...||..:|...|    ..::|..|::|.|:.                  ||..
  Fly   146 LM---LFKLKMAALLPLAIGFLALISFKALVIGKIALLLSGII------------------GLKK 189

  Fly   287 LFGGKNTFPEYNPQGVGAATYYHHHEHFEGGHGGAPGPYYRQEPSFAKPYTDYYSKSYQGQQVQG 351
            |...|    :.|.:.|.       |.|:|..|.                    |.:|......|.
  Fly   190 LLESK----KENYEVVA-------HPHYEHEHS--------------------YGRSLPSDDSQA 223

  Fly   352 QQV 354
            ||:
  Fly   224 QQL 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi2NP_001262303.1 DUF1676 108..224 CDD:285181 28/118 (24%)
Osi9NP_649628.2 DUF1676 54..144 CDD:285181 26/116 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.