DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi2 and Osi21

DIOPT Version :9

Sequence 1:NP_001262303.1 Gene:Osi2 / 40756 FlyBaseID:FBgn0037410 Length:390 Species:Drosophila melanogaster
Sequence 2:NP_609501.1 Gene:Osi21 / 34566 FlyBaseID:FBgn0283678 Length:282 Species:Drosophila melanogaster


Alignment Length:287 Identity:57/287 - (19%)
Similarity:99/287 - (34%) Gaps:98/287 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 FGLGNDNDPFLA---RTNSNCLG-GDLSECFKTQALNTFDEIFFKDQYKLSDFARVVRLPETQQR 134
            :|||    |.:|   |...:|.. .|...|.|.:||:.......:|..|:.|...:.:..:::..
  Fly    45 WGLG----PEMALVRRVYDDCQDKNDFIGCLKQKALHALSRALDQDSIKIVDGLALEKQNQSETE 105

  Fly   135 SLLQEPFEYSEEPRGDDDEWNQLLKYG---------LRRAERFIKSTALEVEWPEELTEAGRYEA 190
            |:|           |...:..|   :|         |.:|::.:::..|:::.            
  Fly   106 SIL-----------GSLTDARQ---FGNLSPIDRALLSKADKLMRTHTLKIDM------------ 144

  Fly   191 RFIGNDIDGELDLIDDGQRAGHFSRK-----KLKKMIIPLLLVLKI---FKLKLLLFLPFILGIA 247
                 |:.|..|.:  |:..||..:|     .:|.::..||..:.|   ..||.|      ..||
  Fly   145 -----DVGGGEDSV--GREHGHKKKKHKEGGHIKYVVAALLTAMGIAGPLGLKAL------AAIA 196

  Fly   248 GLKKILGLAAIVLPGLFAYFKL-------------------------CRPPGGVGGAFGGGLSGL 287
            |...::...|:.:.|:.|..||                         .||......|.|.|..|:
  Fly   197 GKALVISKVALTIAGIIALKKLFSHDHSEETSFQVHAGEHNRRNTYVIRPVSKTSAAAGAGGVGV 261

  Fly   288 --FGGKNTFPEYNPQGVGAATYYHHHE 312
              .||.::...|.       .||.:|:
  Fly   262 TAAGGSSSVDPYR-------YYYEYHQ 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi2NP_001262303.1 DUF1676 108..224 CDD:285181 19/129 (15%)
Osi21NP_609501.1 DUF1676 79..>152 CDD:285181 13/103 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21879
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.