DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi24 and Osi13

DIOPT Version :10

Sequence 1:NP_649620.2 Gene:Osi24 / 40755 FlyBaseID:FBgn0037409 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_649634.1 Gene:Osi13 / 40769 FlyBaseID:FBgn0037422 Length:210 Species:Drosophila melanogaster


Alignment Length:153 Identity:32/153 - (20%)
Similarity:56/153 - (36%) Gaps:61/153 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 KQESESSAAAFKNQTI-----TSIDAELKGL--EDLLVDYV----EQFFSNGRYEPTPGLVLALQ 180
            :|::|..|||.:.|.:     :..:.:|..|  :||..:.|    |.:.:.||            
  Fly    40 EQDAEQEAAAEERQRVERHWLSMAETQLHSLITDDLSTEEVNNMLETWSTEGR------------ 92

  Fly   181 QNHSHPQSYTGKRTTRSILEDTNVELNVPRAFESARLLFFSGLKKVMWPIYMGLQVLKSVLFAMF 245
                      ||...:                        ..|.|:::|:...:.|.|.||..:.
  Fly    93 ----------GKHKKQ------------------------KKLMKMVYPLLAAVAVAKVVLLPLI 123

  Fly   246 LP--TIISSVSRLIGK--GITSG 264
            |.  |.:|:.|.::||  .:|||
  Fly   124 LKWLTALSTSSFVMGKIALVTSG 146

Return to query results.
Submit another query.