DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi24 and Osi9

DIOPT Version :10

Sequence 1:NP_649620.2 Gene:Osi24 / 40755 FlyBaseID:FBgn0037409 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_649628.2 Gene:Osi9 / 40763 FlyBaseID:FBgn0037416 Length:233 Species:Drosophila melanogaster


Alignment Length:121 Identity:27/121 - (22%)
Similarity:46/121 - (38%) Gaps:38/121 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 IDAELKGLEDLLVDYVEQFFSNGRYEPTPGLVLALQQNHSHPQSYTGKRTTRSILEDTNVELNVP 209
            ::|....::.|||:.|.:||.                  :|...:   :..:..::|      :.
  Fly    88 VEAREAEVDSLLVERVARFFG------------------THTLQF---KVPKDSIQD------MQ 125

  Fly   210 RAFESARLLFFSGLKKVMWPIYMGLQVLKSVLFAMFLP------TIISSVSRLIGK 259
            ||.|.:|     |.||......|.|.:|..:..|..||      .:||..:.:|||
  Fly   126 RALEESR-----GKKKEKKKYLMPLLMLFKLKMAALLPLAIGFLALISFKALVIGK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi24NP_649620.2 None
Osi9NP_649628.2 DUF1676 34..189 CDD:462310 27/121 (22%)

Return to query results.
Submit another query.