DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Osi24 and Osi8

DIOPT Version :10

Sequence 1:NP_649620.2 Gene:Osi24 / 40755 FlyBaseID:FBgn0037409 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_649627.1 Gene:Osi8 / 40762 FlyBaseID:FBgn0037415 Length:274 Species:Drosophila melanogaster


Alignment Length:216 Identity:29/216 - (13%)
Similarity:62/216 - (28%) Gaps:98/216 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 RRRNFKHP-----SDSPRKQESESS---------------------------AAAFKNQTITSID 146
            |..:::|.     |.:||.|...|:                           :...|.:.:|.::
  Fly    22 RSASYQHQNPNSLSSAPRPQVQNSNPGMGSTGLWKDMSMVYRIYQQCSGDNMSVCLKVKLLTGLE 86

  Fly   147 AELKGLEDLLVDYVEQFFSNGRYEPTPGLVLALQQNHSHPQSYTGKRTTRSILEDTNVELNVPRA 211
            ...:..:.|.:....||.|:|.                     ..:.|.|:.:.:.::|..:||:
  Fly    87 KAFRSAKSLSLMEGIQFVSSGG---------------------ESEETKRAPISEKDIEAVLPRS 130

  Fly   212 FESARLLF---------------------------FSGLKK---------VMWPIYMGLQVLKSV 240
            .::...:.                           ..|.||         :|.|:.:|       
  Fly   131 VDAKEQVLNNMILKRVGNFLQDHTLQVKFDNEANSVEGRKKKEKKGNGAMIMIPLLLG------- 188

  Fly   241 LFAMFLPTIISSVSRLIGKGI 261
              ...:|....:::.|.||.:
  Fly   189 --GTIVPLAYGALAMLAGKAL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Osi24NP_649620.2 None
Osi8NP_649627.1 DUF1676 67..222 CDD:462310 22/171 (13%)

Return to query results.
Submit another query.