DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPFR and prlh2r

DIOPT Version :9

Sequence 1:NP_001246947.1 Gene:NPFR / 40754 FlyBaseID:FBgn0037408 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001108619.1 Gene:prlh2r / 797157 ZFINID:ZDB-GENE-120411-41 Length:371 Species:Danio rerio


Alignment Length:331 Identity:97/331 - (29%)
Similarity:163/331 - (49%) Gaps:25/331 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 MLISMYGVLIVFGALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEIL-SKY 151
            :.|.:|.:|::....||.|::|.:.....:.:..|..|.|||:.||::||..:|||..... .:.
Zfish    36 LFIPLYTMLVLIACSGNLLLLILIGLNKKLHSTTNFLIGNLALVDLVMCLFCVPLTAFYAFDERG 100

  Fly   152 WPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYP--TRDSLQFVGAVTILAGIWALA 214
            |.:|  ..:|..:.::|...:|.:.:|:||||.|||.|:.||  .|....|.|  .::..||..|
Zfish   101 WVFG--QFMCHFVTLMQTATVFAAVLSLTAIAVDRYVVVAYPIRRRGGRWFCG--WLVVSIWLCA 161

  Fly   215 LLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRN-GRFYYSIFSLCVQYLVPILIVS 278
            |.:::|..::...::      |.:.|.:..:  |.|.|..:. .|..||.|.|.:.|.||:..||
Zfish   162 LAMSTPTALHTVYLD------LSETGHEMAV--CEEFWHGQELSRLIYSCFFLLLSYFVPLAAVS 218

  Fly   279 VAYFGIYNKLKSRITVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLPLNFFNLYADME 343
            ::|..|...|:.|.| ..:.|::...:.:.||:.::|..||:...:.|..|||||...||..|::
Zfish   219 ISYCAISCHLQHRAT-PRLMAATPSNQEKWGRKRRKTFRLLLVSVLSFAFSWLPLQIVNLIRDLD 282

  Fly   344 RSPVTQS---MLVRYAICHMIGMSSACSNPLLYGWLNDNF-----RKEFQELLCRCSDTNVALNG 400
            ......|   :.|....||::.|||||.||.:|..|:..|     ...||:....|:.:::..:.
Zfish   283 TDFAILSKNHVNVIQVSCHLLAMSSACYNPFIYASLHKKFLSYLCHNMFQKRKAHCTQSSITTSS 347

  Fly   401 HTTGCN 406
            ..|..|
Zfish   348 RMTRLN 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPFRNP_001246947.1 7tm_4 98..>195 CDD:304433 32/99 (32%)
7tm_1 103..373 CDD:278431 86/276 (31%)
prlh2rNP_001108619.1 7tm_1 63..315 CDD:278431 82/264 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.