DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPFR and npy2rl

DIOPT Version :9

Sequence 1:NP_001246947.1 Gene:NPFR / 40754 FlyBaseID:FBgn0037408 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001314731.1 Gene:npy2rl / 795311 ZFINID:ZDB-GENE-111115-4 Length:373 Species:Danio rerio


Alignment Length:336 Identity:116/336 - (34%)
Similarity:188/336 - (55%) Gaps:35/336 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 MLISMYGVLIVFGALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYW 152
            :||..|..:|:.|.:||:||:..|.:...:||..|.||.|||::|||:..:.:|.||...|.:.|
Zfish    46 VLILAYSTIILLGVVGNSLVIYVVYKFKTLRTVTNFFIANLAVADLLVNTLCLPFTLAYTLLREW 110

  Fly   153 PYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVY-----PTRDSLQFVGAVTILAGIWA 212
            .:|  .:||.|:...|.|.:.||||::..||.||::.|||     .::|:...|.|:|     |.
Zfish   111 KFG--QVLCFTLPYAQGLAVHVSTITLNVIALDRHRCIVYHLDTRMSKDTCFLVIAIT-----WV 168

  Fly   213 LALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWP-SRNGRFYYSIFSLCVQYLVPILI 276
            ::.:|||||.:::|....|       :...::|..|.|.|| |......|||.:|.:||::|:.|
Zfish   169 VSAVLASPLAIFREYGIVD-------LSPDNSIEVCGEKWPDSSTDSTLYSISTLLLQYVLPLAI 226

  Fly   277 VSVAYFGIYNKLKSRITVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLPLNFFNLYAD 341
            :|.||..|::||::.::.|.        :.:|..|.::|..:|:::.::|.|||||.:.|.|..|
Zfish   227 ISFAYIRIWSKLRNHVSPVG--------RNDRHHRRRKTTKMLVTMVVVFAVSWLPFHAFQLAID 283

  Fly   342 MERSPV-TQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQELLCRCSDTNVALNGHTTGC 405
            ::.|.: .:...:.|.:.|::.|.|..:|||||||:|.|:|..|..:. ||.:...:|  ||.| 
Zfish   284 IDHSVLDMKDFRLLYTVFHIVAMCSTFANPLLYGWMNRNYRSAFVAVF-RCKERLDSL--HTEG- 344

  Fly   406 NVQAAARRRRK 416
              |.||..|.|
Zfish   345 --QPAATVRSK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPFRNP_001246947.1 7tm_4 98..>195 CDD:304433 39/101 (39%)
7tm_1 103..373 CDD:278431 92/276 (33%)
npy2rlNP_001314731.1 7tm_4 55..331 CDD:304433 102/297 (34%)
7tm_1 61..316 CDD:278431 92/276 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 161 1.000 Domainoid score I3972
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.