DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPFR and TACR3

DIOPT Version :10

Sequence 1:NP_001246947.1 Gene:NPFR / 40754 FlyBaseID:FBgn0037408 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001050.1 Gene:TACR3 / 6870 HGNCID:11528 Length:465 Species:Homo sapiens


Alignment Length:53 Identity:12/53 - (22%)
Similarity:19/53 - (35%) Gaps:8/53 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 CIKNEDGKLHCL-GKTKGRHHPDVEPSVLKTLREFYGPENKKFYQMINHWFDW 291
            |..:||..:.|. .:.:....||:.|:...       ||..........:|||
Human   945 CGHHEDAGVICSDAQIQSTTRPDLWPTTTT-------PETTTELLTTTPYFDW 990

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPFRNP_001246947.1 7tmA_NPYR-like 88..384 CDD:320331 12/53 (23%)
TM helix 1 88..114 CDD:320331
TM helix 2 121..146 CDD:320331
TM helix 3 161..191 CDD:320331
TM helix 4 202..223 CDD:320331
TM helix 5 258..287 CDD:320331 5/28 (18%)
TM helix 6 310..340 CDD:320331
TM helix 7 352..377 CDD:320331
TACR3NP_001050.1 7tmA_NKR_NK3R 86..367 CDD:320669
TM helix 1 87..113 CDD:320669
TM helix 2 120..146 CDD:320669
TM helix 3 158..188 CDD:320669
TM helix 4 199..220 CDD:320669
TM helix 5 244..273 CDD:320669
TM helix 6 292..322 CDD:320669
TM helix 7 335..360 CDD:320669
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..465
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.