DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPFR and Npy2r

DIOPT Version :9

Sequence 1:NP_001246947.1 Gene:NPFR / 40754 FlyBaseID:FBgn0037408 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_076458.1 Gene:Npy2r / 66024 RGDID:620475 Length:381 Species:Rattus norvegicus


Alignment Length:396 Identity:124/396 - (31%)
Similarity:196/396 - (49%) Gaps:61/396 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SDLNET--------GSRPL----------DPVLIDRFLSNRAVDSPWYHMLISMYGVLIVFGALG 103
            :|.|:|        ||.|.          :|.|||   |.:.|:.  ..:||..|..:|:.|.:|
  Rat     8 ADENQTVEVKVELYGSGPTTPRGELPPDPEPELID---STKLVEV--QVVLILAYCSIILLGVVG 67

  Fly   104 NTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIAMLQ 168
            |:||:..||:...|||..|.||.|||::|||:..:.:|.||...|...|..|  .:||..:...|
  Rat    68 NSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCLPFTLTYTLMGEWKMG--PVLCHLVPYAQ 130

  Fly   169 ALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFVYKELINTDTP 233
            .|.:.||||::|.||.||::.|||.....:....:..|:...|.::.||||||.:::|       
  Rat   131 GLAVQVSTITLTVIALDRHRCIVYHLESKISKQISFLIIGLAWGVSALLASPLAIFRE------- 188

  Fly   234 ALLQQIGLQDTIP-----YCIEDWPSRNGRFY---YSIFSLCVQYLVPILIVSVAYFGIYNKLKS 290
                 ..|.:.||     .|.|.||......|   ||:.:|.:.|::|:.|:|.:|..|::|||:
  Rat   189 -----YSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLSTLLILYVLPLGIISFSYTRIWSKLKN 248

  Fly   291 RITVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLPLNFFNLYADMERS--PVTQSMLV 353
            .::..|......||:       .:|..:|:.:.::|.||||||:.|.|..|::..  .:.:..|:
  Rat   249 HVSPGAASDHYHQRR-------HKTTKMLVCVVVVFAVSWLPLHAFQLAVDIDSHVLDLKEYKLI 306

  Fly   354 RYAICHMIGMSSACSNPLLYGWLNDNFRKEFQELLCRCSDTNVALNGHTTGCNVQAAARRRRKLG 418
             :.:.|:|.|.|..:|||||||:|.|:||.|.... ||.....|::.     .|....:.::.|.
  Rat   307 -FTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAF-RCEQRLDAIHS-----EVSMTFKAKKNLE 364

  Fly   419 AELSKG 424
            .:.:.|
  Rat   365 VKKNNG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPFRNP_001246947.1 7tm_4 98..>195 CDD:304433 41/96 (43%)
7tm_1 103..373 CDD:278431 92/279 (33%)
Npy2rNP_076458.1 7tm_4 61..340 CDD:304433 103/300 (34%)
7tm_1 67..325 CDD:278431 92/279 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.