DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPFR and npy8ar

DIOPT Version :9

Sequence 1:NP_001246947.1 Gene:NPFR / 40754 FlyBaseID:FBgn0037408 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_571512.1 Gene:npy8ar / 30714 ZFINID:ZDB-GENE-990415-175 Length:373 Species:Danio rerio


Alignment Length:315 Identity:106/315 - (33%)
Similarity:171/315 - (54%) Gaps:24/315 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 MLISMYGVLIVFGALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYW 152
            :||..|..:|..|.:|||.:|..:.|:..||...|:.|.||:.||:|:|:|.:|:|::..|...|
Zfish    32 LLIVAYSTVIAVGLVGNTCLVFIISRQKEMRNVTNILIANLSCSDILMCVVCLPVTVIYTLMDRW 96

  Fly   153 PYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLL 217
            ..|  ..|||....:|.:.:.||..|:..||.:|:|:|::||..:.....:...:|..|.:|..:
Zfish    97 ILG--ETLCKVTPFVQCMSVTVSIFSLVLIALERHQLIIHPTGWTPAAGHSYLAVAVTWMVACFI 159

  Fly   218 ASPLFVYKELINTDTPALLQQIGLQDTIPY--------CIEDWPSRNGRFYYSIFSLCVQYLVPI 274
            :.|...:..|.|    |..|.|.|    |:        |:|.|||...|..|:...|..||.:|:
Zfish   160 SLPFLSFNILTN----APFQNISL----PFNPFSDHVICMELWPSERNRLAYTTSLLLFQYCLPL 216

  Fly   275 LIVSVAYFGIYNKLKSRITVVAVQASSAQRKVERGRRMKRTNCLLISIAIIFGVSWLPLNFFNLY 339
            |::.:.|..|:.:|:.|..:|. ||:.|:::..||  .:|.|.:|:.|.:.|.:.|||||.||..
Zfish   217 LLILLCYLRIFLRLRRRKDMVE-QATEARQRKARG--AQRVNAMLVVIVVAFALCWLPLNVFNTI 278

  Fly   340 ADM--ERSPVTQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQELLCRCS 392
            .|.  :..|..|..:: ::.||:..|:|.|.||::||:||.||:||.:..|.||:
Zfish   279 FDWYHQALPACQHDVI-FSACHLTAMASTCVNPVVYGFLNTNFQKELKATLQRCN 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPFRNP_001246947.1 7tm_4 98..>195 CDD:304433 35/96 (36%)
7tm_1 103..373 CDD:278431 90/279 (32%)
npy8arNP_571512.1 7tm_4 43..>128 CDD:304433 31/86 (36%)
7tm_1 47..313 CDD:278431 90/279 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 161 1.000 Domainoid score I3972
eggNOG 1 0.900 - - E33208_3BAX7
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I3820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D275052at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6023
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.