DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPFR and CG30340

DIOPT Version :9

Sequence 1:NP_001246947.1 Gene:NPFR / 40754 FlyBaseID:FBgn0037408 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_724812.2 Gene:CG30340 / 246550 FlyBaseID:FBgn0050340 Length:396 Species:Drosophila melanogaster


Alignment Length:383 Identity:86/383 - (22%)
Similarity:152/383 - (39%) Gaps:74/383 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 WYH-------MLISMYGVLIVFGALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPL 142
            |.|       ..|..:..||.||..||..:|..:.....:|:..||.|.|:|::| ||.|...|.
  Fly    23 WLHKPNGEITWKICTFLPLIAFGLYGNFSMVYVIATNRSLRSPTNLIIANMAVAD-LLTLAICPA 86

  Fly   143 TLMEILSKYWPYGSCSILCKTIAMLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTIL 207
            ..| :...|..|....:.||....|..:.:..:.::::.:::||...||.|....|...|...::
  Fly    87 MFM-VNDFYQNYQLGCVGCKLEGFLVVVFLITAVLNLSVVSYDRLTAIVLPMETRLTIRGVQIVV 150

  Fly   208 AGIWALALLLASPLFVYKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLV 272
            ...|...:||||||..|:        :...::....|..||.|: .|...:::|.:.::.|  .:
  Fly   151 VCTWVSGILLASPLAFYR--------SYRVRVWKNFTERYCKEN-TSVLPKYWYVLITILV--WL 204

  Fly   273 PILIVSVAYFGIYNKLKSRITVVAVQASSAQRKVERGRRMKRTNCLLIS-----------IAIIF 326
            |:.|:.:.|..|:.||.               :.|: |.:.|.|.|.:|           :.::|
  Fly   205 PLGIMLICYIAIFYKLD---------------RYEK-RVLSRENPLTVSYKRSVAKTLFIVVVVF 253

  Fly   327 GVSWLPLNFFNLYADM---ERSPVTQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQEL- 387
            ....||.....:..:.   |...|:..|.:.:.|...:...:|..|||:||:.|:|||:.:.:: 
  Fly   254 AALRLPFTILVVLREKYFGEDVSVSSGMQLFWYISQYLMFLNAAVNPLIYGFNNENFRRAYYQIS 318

  Fly   388 --------------------LCRCSDTNVALNGHTTGCNVQAAARRRRKLGAELSKGE 425
                                .|.|:   ...||..|....|.|....:.:..::|..:
  Fly   319 WVRRWRDATQMKKFSRSPDHCCYCA---FMKNGKRTSEAAQKAGNLEKDISKDMSSAQ 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPFRNP_001246947.1 7tm_4 98..>195 CDD:304433 27/96 (28%)
7tm_1 103..373 CDD:278431 65/283 (23%)
CG30340NP_724812.2 7tm_4 44..315 CDD:304433 73/299 (24%)
7tm_1 48..303 CDD:278431 65/283 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471357
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.