DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NPFR and NPFFR2

DIOPT Version :9

Sequence 1:NP_001246947.1 Gene:NPFR / 40754 FlyBaseID:FBgn0037408 Length:489 Species:Drosophila melanogaster
Sequence 2:NP_001138228.1 Gene:NPFFR2 / 10886 HGNCID:4525 Length:423 Species:Homo sapiens


Alignment Length:378 Identity:108/378 - (28%)
Similarity:185/378 - (48%) Gaps:60/378 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 HPLDYLDLGTVHALNTTAINTSDLNETGSRPLDPVLIDRFLSNRAVDSPWYHMLISMYGVLIVFG 100
            ||:..:: .|.|.|      .||:|.|        .::.:|....|.:    :.|..|.::....
Human    17 HPIWNVN-DTKHHL------YSDINIT--------YVNYYLHQPQVAA----IFIISYFLIFFLC 62

  Fly   101 ALGNTLVVIAVIRKPIMRTARNLFILNLAISDLLLCLVTMPLTLMEILSKYWPYGSCSILCKTIA 165
            .:|||:|...|:|...|.|..|||||||||||||:.:..||:||::.:...||:|  :.:||...
Human    63 MMGNTVVCFIVMRNKHMHTVTNLFILNLAISDLLVGIFCMPITLLDNIIAGWPFG--NTMCKISG 125

  Fly   166 MLQALCIFVSTISITAIAFDRYQVIVYPTRDSLQFVGAVTILAGIWALALLLASPLFV------- 223
            ::|.:.:..|..::.|||.||:|.:|||.:..|....|..|:..||.||:.:.||..|       
Human   126 LVQGISVAASVFTLVAIAVDRFQCVVYPFKPKLTIKTAFVIIMIIWVLAITIMSPSAVMLHVQEE 190

  Fly   224 --YKELINTDTPALLQQIGLQDTIPYCIEDWPSRNGRFYYSIFSLCVQYLVPILIVSVAYFGIYN 286
              |:..:|:....        ..:.:|.||||::..|..|:.......||.|:.::.:.|     
Human   191 KYYRVRLNSQNKT--------SPVYWCREDWPNQEMRKIYTTVLFANIYLAPLSLIVIMY----- 242

  Fly   287 KLKSRITVVAVQAS---SAQRKVER----GRRMKRTNCLLISIAIIFGVSWLP---LNFFNLYAD 341
               .||.:...:|:   :.::..|:    .|:.::...:|:.:|::|.:||||   |...:.|||
Human   243 ---GRIGISLFRAAVPHTGRKNQEQWHVVSRKKQKIIKMLLIVALLFILSWLPLWTLMMLSDYAD 304

  Fly   342 MERSPVTQSMLVRYAICHMIGMSSACSNPLLYGWLNDNFRKEFQEL----LCR 390
            :..:.:....:..|...|.:...::..||::||:.|:|||:.|||.    ||:
Human   305 LSPNELQIINIYIYPFAHWLAFGNSSVNPIIYGFFNENFRRGFQEAFQLQLCQ 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NPFRNP_001246947.1 7tm_4 98..>195 CDD:304433 41/96 (43%)
7tm_1 103..373 CDD:278431 84/288 (29%)
NPFFR2NP_001138228.1 7tm_4 56..>178 CDD:304433 48/123 (39%)
7tm_1 65..336 CDD:278431 84/288 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3897
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.