DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1077 and CG44090

DIOPT Version :10

Sequence 1:NP_649617.1 Gene:CG1077 / 40751 FlyBaseID:FBgn0037405 Length:730 Species:Drosophila melanogaster
Sequence 2:NP_001262667.1 Gene:CG44090 / 14462482 FlyBaseID:FBgn0264899 Length:99 Species:Drosophila melanogaster


Alignment Length:103 Identity:29/103 - (28%)
Similarity:47/103 - (45%) Gaps:28/103 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 GVCPKANAVPQISEKPPVPVPCTRIYRPVCAMY----AGV------KSTFSNECLVNAENIKSQR 183
            |:...|.|.|.:.:   .|.||||.||||||.:    .|.      :.||:.||::|....::.:
  Fly    13 GILALAEADPIVEQ---CPSPCTREYRPVCAEWRRHIRGTTRPVISRCTFATECVLNNHRCRTNQ 74

  Fly   184 NWRIVSEGLCGEDSTKMKHSRKQKPKAKPKSDAERTKR 221
            ||..:.|            :||.:.:.   ||.:|.::
  Fly    75 NWVTIDE------------TRKCRNET---SDCDRLRK 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1077NP_649617.1 KAZAL_FS 86..131 CDD:238052 1/1 (100%)
KAZAL_FS 150..193 CDD:412159 18/52 (35%)
KAZAL 335..383 CDD:197624
MSCRAMM_ClfA 606..>691 CDD:468110
CG44090NP_001262667.1 KAZAL_FS 26..85 CDD:412159 21/73 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.