DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31559 and Grxcr2

DIOPT Version :10

Sequence 1:NP_731045.1 Gene:CG31559 / 40749 FlyBaseID:FBgn0051559 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001178007.1 Gene:Grxcr2 / 681048 RGDID:1584696 Length:248 Species:Rattus norvegicus


Alignment Length:173 Identity:44/173 - (25%)
Similarity:69/173 - (39%) Gaps:37/173 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 QPNAKNFKEK--------DLGKVVLYTTSMGIIRETYTKCANVKQILRTLLVK---FEERDVFMS 346
            ||...::|..        |.||:::||.::.|||....|    :..:|.:|.|   .||..:.::
  Rat   100 QPLFNDYKANDHKPPPIIDFGKIIIYTNNLKIIRTPMDK----RDFMRKILQKEEVAEEESLMIT 160

  Fly   347 VEYQAEMRQRMQSGQVRVPQLYVEGQHIGDAETVERMNESGELRQLLKPYKSMASTYTCQTCGGY 411
            .|...: |::..|......:.::..||..|....|.                     .|..|.|.
  Rat   161 GENDGD-REQNSSPLPETDRTFLHSQHTQDGLVPED---------------------NCLHCQGS 203

  Fly   412 RLLPCPSCNGSKKSVHRNHFTAEFVALKCMNCDEVGLVKCHNC 454
            .:..|..|:|||.|:..|.|...:.||:|..|:|.||..|..|
  Rat   204 GIATCSLCHGSKFSMLANRFKESYRALRCPACNENGLQPCRIC 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31559NP_731045.1 GRX_GRX_like 306..451 CDD:239329 37/147 (25%)
Grxcr2NP_001178007.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold <197..243 CDD:469754 18/45 (40%)

Return to query results.
Submit another query.