DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31559 and GRXCR2

DIOPT Version :10

Sequence 1:NP_731045.1 Gene:CG31559 / 40749 FlyBaseID:FBgn0051559 Length:454 Species:Drosophila melanogaster
Sequence 2:NP_001073985.1 Gene:GRXCR2 / 643226 HGNCID:33862 Length:248 Species:Homo sapiens


Alignment Length:176 Identity:48/176 - (27%)
Similarity:72/176 - (40%) Gaps:43/176 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 QPNAKNFKEK--------DLGKVVLYTTSMGIIRETYTKCANVKQILRTLLVKFEERDVFMSVEY 349
            ||...::|..        |.||:::||.::.|||....|    :..:|.:|.|.||      .|.
Human   100 QPRFNDYKANDHKPLPIIDFGKIIIYTNNLKIIRTPMDK----RDFVRKILQKEEE------AEE 154

  Fly   350 QAEMRQRMQSGQVRVPQLYVEGQH---IGDAETV---ERMNESGELRQLLKPYKSMASTYTCQTC 408
            ::.|.:....|.        ..||   :.:||:.   .|..:.|::     |..|      |..|
Human   155 ESLMNKEESYGG--------RDQHDRPLVEAESTLPQNRYTQEGDI-----PEDS------CFHC 200

  Fly   409 GGYRLLPCPSCNGSKKSVHRNHFTAEFVALKCMNCDEVGLVKCHNC 454
            .|.....|..|:|||.|:..|.|...:.||:|..|:|.||..|..|
Human   201 RGSGSATCSLCHGSKFSMLANRFKESYRALRCPACNENGLQPCQIC 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31559NP_731045.1 GRX_GRX_like 306..451 CDD:239329 41/150 (27%)
GRXCR2NP_001073985.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 150..172 7/35 (20%)
Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold <197..243 CDD:469754 18/45 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.