DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83ef and Obp83a

DIOPT Version :10

Sequence 1:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001287190.1 Gene:Obp83a / 40737 FlyBaseID:FBgn0011281 Length:174 Species:Drosophila melanogaster


Alignment Length:112 Identity:20/112 - (17%)
Similarity:41/112 - (36%) Gaps:33/112 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 CSRQLNATNVELLQYS--KLKSKEPIPCLFQCFADAMGFYDPDGNWRLENWKQAFGPSGNEDQSS 199
            |..:...|...:.::|  ::...|.:.|...||...:...|.:|:..||..              
  Fly    75 CVEKTGVTEAAIKEFSDGEIHEDEKLKCYMNCFFHEIEVVDDNGDVHLEKL-------------- 125

  Fly   200 GADYSGCRLSGTQREVALSK----------C--SWMYHEYKCWERVN 234
               ::...||...:.:.:||          |  :|.:|:  ||::.:
  Fly   126 ---FATVPLSMRDKLMEMSKGCVHPEGDTLCHKAWWFHQ--CWKKAD 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83efNP_731042.1 PhBP 28..124 CDD:214783
PhBP 133..234 CDD:214783 20/110 (18%)
Obp83aNP_001287190.1 PhBP 71..167 CDD:214783 20/110 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.