DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83ef and Obp56f

DIOPT Version :10

Sequence 1:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster


Alignment Length:99 Identity:16/99 - (16%)
Similarity:29/99 - (29%) Gaps:40/99 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 CLAREKGWFDVEENKWRLKQLTEDLGADVYNYCRFELRRM------------------------- 105
            ||.|:.|:...|..|:..|:  :.|.:..:.:|..|::.:                         
  Fly    29 CLKRQLGYTITENTKFDAKE--DSLQSKCFYHCLLEVKGVIANDAISSEQPRKVLEKKYGITDTD 91

  Fly   106 -------------GSDGCSFAYRGLRCLKQAEMH 126
                         .|..|...|..|:|.:....|
  Fly    92 ELEKAEEKCHSIKASGKCELGYEILKCYQSITKH 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83efNP_731042.1 PhBP 28..124 CDD:214783 15/95 (16%)
PhBP 133..234 CDD:214783
Obp56fNP_725926.1 PBP_GOBP <49..120 CDD:460193 8/70 (11%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.