DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83ef and LOC1277701

DIOPT Version :10

Sequence 1:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_061512249.1 Gene:LOC1277701 / 1277701 VectorBaseID:AGAMI1_013180 Length:185 Species:Anopheles gambiae


Alignment Length:84 Identity:21/84 - (25%)
Similarity:35/84 - (41%) Gaps:23/84 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RAVLVSLFL-ICSQALAD----------------LSGDAQTLEKCLRQLSSPESIAGDLRKLERY 52
            |.|::|.|| :|..||..                :...::|::.|..:|  |.|:...|.::.||
Mosquito     3 RQVIISYFLAVCLLALVQVIYRQVCALLEITNTIIFPQSETVQDCENKL--PPSLKSRLCEIRRY 65

  Fly    53 SSWTREE----VPCLMRCL 67
            ......|    :.|:||.|
Mosquito    66 EIIEGPEMDKHIHCVMRAL 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83efNP_731042.1 PhBP 28..124 CDD:214783 13/44 (30%)
PhBP 133..234 CDD:214783
LOC1277701XP_061512249.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.