DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83cd and Obp99b

DIOPT Version :9

Sequence 1:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_001263078.1 Gene:Obp99b / 43497 FlyBaseID:FBgn0039685 Length:149 Species:Drosophila melanogaster


Alignment Length:145 Identity:35/145 - (24%)
Similarity:55/145 - (37%) Gaps:34/145 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILIALCLCLSLNEGLA--LLEHEGETINRCIQNYGGLT----------AENAERLERFKEWSDSY 59
            :||.|.|      |||  |.:|.....:..::.:..||          ..:.|.:|::|:|....
  Fly     3 VLIVLLL------GLAFVLADHHHHHHDYVVKTHEDLTNYRTQCVEKVHASEELVEKYKKWQYPD 61

  Fly    60 EEIPCFTRCYLS---EMFDFYNNLTGFNKDGIVGVFGRP---------VYEACRKKLELPFESGE 112
            :.:   |.|||.   :.|.||:...||:...|......|         |::......|...:.|:
  Fly    62 DAV---THCYLECIFQKFGFYDTEHGFDVHKIHIQLAGPGVEVHESDEVHQKIAHCAETHSKEGD 123

  Fly   113 SSCKHAYEGFHCITN 127
             ||..||....|..|
  Fly   124 -SCSKAYHAGMCFMN 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 26/120 (22%)
PhBP 149..242 CDD:214783
Obp99bNP_001263078.1 PBP_GOBP 24..137 CDD:396118 25/116 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.