DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83cd and Obp99d

DIOPT Version :9

Sequence 1:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_651712.1 Gene:Obp99d / 43496 FlyBaseID:FBgn0039684 Length:137 Species:Drosophila melanogaster


Alignment Length:93 Identity:20/93 - (21%)
Similarity:36/93 - (38%) Gaps:23/93 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ERLERFKEWSDSYEEIPCFTRCYLSEMFDFYNNLTGFNKDGIVGVFG--------RPVYEACRKK 103
            |.||:.::  :|.||.....||.:.:: ..:.:.:|:|...|..:|.        ..|.|.|.:.
  Fly    38 EDLEKCRQ--ESQEEDAATLRCLVKKL-GLWTDESGYNARRIAKIFAGHNQMEELMLVVEHCNRM 99

  Fly   104 LELPFESGESSCKH----AYEGFHCITN 127
                    |....|    |:..:.|.|:
  Fly   100 --------EQDTSHLDDWAFLAYRCATS 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 20/93 (22%)
PhBP 149..242 CDD:214783
Obp99dNP_651712.1 PBP_GOBP <38..116 CDD:279703 18/88 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.