DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83cd and Obp99a

DIOPT Version :10

Sequence 1:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_651707.1 Gene:Obp99a / 43488 FlyBaseID:FBgn0039678 Length:142 Species:Drosophila melanogaster


Alignment Length:161 Identity:33/161 - (20%)
Similarity:67/161 - (41%) Gaps:48/161 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILIALCLCLSLNEGLALLEHEGETI---NRCIQNYGGLTAENAERLERFKEWSDSYEEIP----- 63
            :.:|:|:.:.|.....::::..:.:   :.|::.    .|...:.:|::::|     |.|     
  Fly     3 VFVAICVLIGLASADYVVKNRHDMLAYRDECVKE----LAVPVDLVEKYQKW-----EYPNDAKT 58

  Fly    64 -CFTRCYLSE--MFDFYNNLTGFNKDGI----VG-------VFGRPVYEACRKKLELPFESGESS 114
             |:.:|..::  :||..   :|||.:.|    ||       .|...: .||..|    .|.|.::
  Fly    59 QCYIKCVFTKWGLFDVQ---SGFNVENIHQQLVGNHADHNEAFHASL-AACVDK----NEQGSNA 115

  Fly   115 CKHAYEGFHCITNMESHPFTVIDNMPNISPS 145
            |:.||.|..|:..         :|:..|..|
  Fly   116 CEWAYRGATCLLK---------ENLAQIQKS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 27/120 (23%)
PhBP 149..242 CDD:214783
Obp99aNP_651707.1 PhBP 29..130 CDD:214783 27/126 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.