DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83cd and Obp83ef

DIOPT Version :9

Sequence 1:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_731042.1 Gene:Obp83ef / 40747 FlyBaseID:FBgn0046876 Length:245 Species:Drosophila melanogaster


Alignment Length:256 Identity:66/256 - (25%)
Similarity:101/256 - (39%) Gaps:44/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQMKSGILIALCLCLSLNEGLALLEHEGETINRCIQNYGG--LTAENAERLERFKEWSDSYEEIP 63
            |.....:|::|.|..|  :.||.|..:.:|:.:|::....  ..|.:..:|||:..|  :.||:|
  Fly     1 MSSPRAVLVSLFLICS--QALADLSGDAQTLEKCLRQLSSPESIAGDLRKLERYSSW--TREEVP 61

  Fly    64 CFTRCYLSE--MFDFYNN---LTGFNKDGIVGVFGRPVYEACRKKLELPFESGESSCKHAYEGFH 123
            |..||...|  .||...|   |....:|     .|..||..||.:|.   ..|...|..||.|..
  Fly    62 CLMRCLAREKGWFDVEENKWRLKQLTED-----LGADVYNYCRFELR---RMGSDGCSFAYRGLR 118

  Fly   124 CITNMESHPFTVIDNMPNISPSAKDAMKDCLQDVHQDEWKSFDAFAYYPVNEPIPCFTRCFVDKL 188
            |:...|.|..|.:..:...|........:.||            ::.....|||||..:||.|.:
  Fly   119 CLKQAEMHAGTSLSTLLQCSRQLNATNVELLQ------------YSKLKSKEPIPCLFQCFADAM 171

  Fly   189 HIFEEKTRLWKLEAMKQNLGIPA-----------KGARIRTCHRHRGRDRCATYYKQFTCY 238
            ..::.... |:||..||..| |:           .|.|:....|.....:|:..|.::.|:
  Fly   172 GFYDPDGN-WRLENWKQAFG-PSGNEDQSSGADYSGCRLSGTQREVALSKCSWMYHEYKCW 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 31/105 (30%)
PhBP 149..242 CDD:214783 23/101 (23%)
Obp83efNP_731042.1 PhBP 28..124 CDD:214783 31/105 (30%)
PhBP 133..234 CDD:214783 24/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F5PU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.