powered by:
Protein Alignment Obp83cd and Obp69a
DIOPT Version :9
Sequence 1: | NP_649612.1 |
Gene: | Obp83cd / 40746 |
FlyBaseID: | FBgn0046878 |
Length: | 242 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_524039.2 |
Gene: | Obp69a / 39411 |
FlyBaseID: | FBgn0011279 |
Length: | 148 |
Species: | Drosophila melanogaster |
Alignment Length: | 72 |
Identity: | 19/72 - (26%) |
Similarity: | 32/72 - (44%) |
Gaps: | 8/72 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 172 PVNEPIPCFTRCFVDKLHIFEEKTRLWKLEAMKQNLGIPAK-----GARIRTCHRHRGRDRCATY 231
|.:..|.||..|..|...:.:.: .:..|||:.:.| |.: ...:.:|...:|:|.|.|.
Fly 63 PTDPEIKCFLYCMFDMFGLIDSQ-NIMHLEALLEVL--PEEIHKTINGLVSSCGTQKGKDGCDTA 124
Fly 232 YKQFTCY 238
|:...||
Fly 125 YETVKCY 131
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Obp83cd | NP_649612.1 |
PhBP |
30..129 |
CDD:214783 |
|
PhBP |
149..242 |
CDD:214783 |
19/72 (26%) |
Obp69a | NP_524039.2 |
PBP_GOBP |
26..133 |
CDD:279703 |
19/72 (26%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR11857 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.