DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83cd and Obp69a

DIOPT Version :10

Sequence 1:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_524039.2 Gene:Obp69a / 39411 FlyBaseID:FBgn0011279 Length:148 Species:Drosophila melanogaster


Alignment Length:72 Identity:19/72 - (26%)
Similarity:32/72 - (44%) Gaps:8/72 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 PVNEPIPCFTRCFVDKLHIFEEKTRLWKLEAMKQNLGIPAK-----GARIRTCHRHRGRDRCATY 231
            |.:..|.||..|..|...:.:.: .:..|||:.:.|  |.:     ...:.:|...:|:|.|.|.
  Fly    63 PTDPEIKCFLYCMFDMFGLIDSQ-NIMHLEALLEVL--PEEIHKTINGLVSSCGTQKGKDGCDTA 124

  Fly   232 YKQFTCY 238
            |:...||
  Fly   125 YETVKCY 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783
PhBP 149..242 CDD:214783 19/72 (26%)
Obp69aNP_524039.2 PhBP 38..135 CDD:214783 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.