DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83cd and Obp44a

DIOPT Version :10

Sequence 1:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_610358.1 Gene:Obp44a / 35789 FlyBaseID:FBgn0033268 Length:143 Species:Drosophila melanogaster


Alignment Length:134 Identity:28/134 - (20%)
Similarity:47/134 - (35%) Gaps:19/134 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MKSGILIALCLCLSLNEGLALLEHEGETINRCIQNYGGLTAENAERLERFKEWSDSYEEIPCFTR 67
            ||:.:.|.||..|.|...........|.:....:.....:......:.::|.:....::|   ||
  Fly     1 MKNAVAILLCALLGLASASDYKLRTAEDLQSARKECAASSKVTEALIAKYKTFDYPDDDI---TR 62

  Fly    68 CYLS---EMFDFYNNLTGFNKDGIVGVFG---------RPVYEACRKKLELPFESGESSCKHAYE 120
            .|:.   ..||.::...||..:.:|...|         :...|.|..|.|....:.|    .|:.
  Fly    63 NYIQCIFVKFDLFDEAKGFKVENLVAQLGQGKEDKAALKADIEKCADKNEQKSPANE----WAFR 123

  Fly   121 GFHC 124
            ||.|
  Fly   124 GFKC 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 20/107 (19%)
PhBP 149..242 CDD:214783
Obp44aNP_610358.1 PhBP 32..132 CDD:214783 20/103 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.