DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83cd and Obp19b

DIOPT Version :9

Sequence 1:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_608391.2 Gene:Obp19b / 33038 FlyBaseID:FBgn0031110 Length:163 Species:Drosophila melanogaster


Alignment Length:154 Identity:31/154 - (20%)
Similarity:60/154 - (38%) Gaps:25/154 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQMKSGILIALCLCLSLNEGLALLEHEGETIN---RCIQNYGGL-----TAENAERLERFKEWSD 57
            ::|.:.:|...|..:.:....|..|....|::   ..|:.:|..     :.||...:...||  |
  Fly    11 LKMTNLLLAVACAAVLMGSATADEEEGSMTVDEVVELIEPFGDACTPKPSRENIVEMVLNKE--D 73

  Fly    58 SYEEIPCFTRCYLSEMFDFYNNLTGFNKDGIVGVF----------GRPVYEACRKKLELPFESGE 112
            :..|..||..|.|.:......:...:|:|..|.:.          ||.:.:.|.::|    ::.:
  Fly    74 AKHETKCFRHCMLEQFELMPEDQLQYNEDKTVDMINMMFPDREDDGRRIVKTCNEEL----KAEQ 134

  Fly   113 SSCKHAYEGFHC-ITNMESHPFTV 135
            ..|:.|:....| :..|.|..|.:
  Fly   135 DKCEAAHGIAMCMLREMRSSGFKI 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 23/117 (20%)
PhBP 149..242 CDD:214783
Obp19bNP_608391.2 PBP_GOBP 38..150 CDD:279703 23/117 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11857
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.