DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83cd and LOC3291553

DIOPT Version :10

Sequence 1:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_551868.2 Gene:LOC3291553 / 3291553 VectorBaseID:AGAMI1_005326 Length:135 Species:Anopheles gambiae


Alignment Length:64 Identity:13/64 - (20%)
Similarity:24/64 - (37%) Gaps:5/64 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 CFTRCFVDKLHIFEEKTRLWKLEAMKQNL----GIPAKGARIRTCHRHRGRDRCATYYKQFTCY 238
            ||.:||.......::...: :.:.:.|.|    |.......:..|..:.|.|.|...::...||
Mosquito    64 CFVQCFFQGAGFVDQDGSV-QTDELTQKLASEYGQEKADELVARCRNNDGPDACERSFRLLQCY 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783
PhBP 149..242 CDD:214783 13/64 (20%)
LOC3291553XP_551868.2 PBP_GOBP 23..129 CDD:460193 13/64 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.