DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83cd and Obp56f

DIOPT Version :10

Sequence 1:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_725926.1 Gene:Obp56f / 246668 FlyBaseID:FBgn0043533 Length:125 Species:Drosophila melanogaster


Alignment Length:124 Identity:29/124 - (23%)
Similarity:38/124 - (30%) Gaps:43/124 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ETINRCIQNYGGLT-AENAERLERFKEWSDSYEEIPCFTRCYLSEMFDFYNNLTGFNKDGIVGVF 92
            |.|..|::...|.| .||.    :|....||.:. .||..|.|.                :.||.
  Fly    24 EKIKACLKRQLGYTITENT----KFDAKEDSLQS-KCFYHCLLE----------------VKGVI 67

  Fly    93 GRPVY--EACRKKLELPF--------ESGESSCKHA----------YEGFHCITNMESH 131
            .....  |..||.||..:        |..|..| |:          ||...|..::..|
  Fly    68 ANDAISSEQPRKVLEKKYGITDTDELEKAEEKC-HSIKASGKCELGYEILKCYQSITKH 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 27/119 (23%)
PhBP 149..242 CDD:214783
Obp56fNP_725926.1 PBP_GOBP <49..120 CDD:460193 20/88 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.