DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83cd and D7r5

DIOPT Version :10

Sequence 1:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_317187.2 Gene:D7r5 / 1277702 VectorBaseID:AGAMI1_004494 Length:166 Species:Anopheles gambiae


Alignment Length:86 Identity:14/86 - (16%)
Similarity:36/86 - (41%) Gaps:17/86 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 PFTVIDNMPNISPSAKDAMKDCLQDVHQDEWKSFDAFAYYPVNEPIPC--FTRCFVDKLHIFEEK 194
            |..:::.:         |:.||::.|.:....:......|.|.:.:..  :.:||:..|...:|.
Mosquito    14 PLIIVETL---------AVSDCVRHVSESARNTVCDVRQYRVTKGVEADRYVQCFMTALGFADES 69

  Fly   195 TRLWK------LEAMKQNLGI 209
            ..:.:      |:|::.:.|:
Mosquito    70 GSIQRSNVLTALDAVETHDGV 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783
PhBP 149..242 CDD:214783 13/69 (19%)
D7r5XP_317187.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.