DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp83cd and LOC1277700

DIOPT Version :10

Sequence 1:NP_649612.1 Gene:Obp83cd / 40746 FlyBaseID:FBgn0046878 Length:242 Species:Drosophila melanogaster
Sequence 2:XP_317184.2 Gene:LOC1277700 / 1277700 VectorBaseID:AGAMI1_010274 Length:168 Species:Anopheles gambiae


Alignment Length:118 Identity:26/118 - (22%)
Similarity:46/118 - (38%) Gaps:23/118 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IALCLCLSLNEGLALLEHEGETINRCIQNYGGLTAENAERLERFKEWSDSYEEIPCFTRCYLSEM 73
            :.|..|| ::.|.|..|   .|:..|.:|.|....:....|.::...|.  :::....:|.| |:
Mosquito     9 VGLVWCL-ISLGQARKE---STVEECEKNIGDSLKDRVCELRQYTPVSS--DDMDKHMQCVL-EV 66

  Fly    74 FDFYNNLTGFNKDGIVGVFGRPVYEACRKKLELPFESGESSCKHAYEGFHCIT 126
            ..|.:. .|..|:.::              ||| .:..:|...||.....|:|
Mosquito    67 VGFVDG-NGEVKESVL--------------LEL-LQRVDSGVNHAANMKKCVT 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp83cdNP_649612.1 PhBP 30..129 CDD:214783 20/97 (21%)
PhBP 149..242 CDD:214783
LOC1277700XP_317184.2 PhBP 26..122 CDD:214783 20/97 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.