DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG17147

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:198 Identity:47/198 - (23%)
Similarity:78/198 - (39%) Gaps:56/198 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENC-DYLHNVD--CGDRTELEPPITTPHCSRL 96
            :||:|.:|.:|...:.||.:..:|:.:..     :| |.|.|.:  ||:|           |..|
  Fly    46 TCDQYIQCYDGNGTVLTCPSNQSFNPSKG-----SCVDTLANSNKYCGNR-----------CEGL 94

  Fly    97 YGIF-PDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMW-ADQVPECKNEEVANGFSCPAAG 159
            .|.: .|..:|..::.|.||.|....|..|..:|..::.|:: .|.:  |  .:|.|  .|....
  Fly    95 DGEWVADPTECHKYFYCMNGVPLAGMCPVGQHFDERSQSCLYGVDSM--C--VDVNN--ICELVA 153

  Fly   160 ELANAGSFSRHAHPEDCRKYYIC------------LEGVAREYGCPIGTVFKIGDSDGTGNCEDP 212
            |      .::..:.:||..||.|            :....|||       |.:    .:|||.:.
  Fly   154 E------NTKFRNEKDCAYYYECDKTGNHASKSCTVTSKKREY-------FDV----ESGNCVEA 201

  Fly   213 EDV 215
            ..|
  Fly   202 NKV 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 9/37 (24%)
CBM_14 97..144 CDD:366726 12/48 (25%)
CBM_14 170..218 CDD:366726 13/58 (22%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 8/35 (23%)
ChtBD2 89..136 CDD:214696 14/57 (25%)
CBM_14 278..332 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.