DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG17145

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001262098.1 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster


Alignment Length:256 Identity:55/256 - (21%)
Similarity:78/256 - (30%) Gaps:86/256 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALFGAAVAQSSFKCPDDFGFYPHDT-----------------------SCDKYWKCDNGVSELKT 51
            ||:|....::.|..........|::                       .|:.|..|:.||.:.||
  Fly   116 ALYGTCPQETHFNATTQMCSRQHESDCTTSTFEYCSIVKNGVNFDNLQGCNMYHVCEKGVLKDKT 180

  Fly    52 CGNGLAFDATDSKYLTENCDYLHNVDCGDRTELEPPITTPHCSRLYGIFPDENK-------CDVF 109
            |..      |..:..|..|.....|||...     |:.|..|.:  ...|.|||       |..:
  Fly   181 CSK------TYYQASTGECVSKALVDCDAH-----PLPTDVCGK--ASKPYENKFVADEATCRGY 232

  Fly   110 WNC-------------WNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVANGFSCPAAGEL 161
            :.|             ||      ||.....:|..:::|:....| .|.::.      |.     
  Fly   233 FYCAKQKDGTPDPNPVWN------QCPQDRFFDASSQMCITPSSV-YCSHDR------CD----- 279

  Fly   162 ANAGSFSRHAHPEDCRKYYICLEGV-AREYGCPIGTVFKIGDSDGTGNCEDPEDVPGCEDY 221
            ....||...| .:.||.|..|.:|| ..|..|  |..|   ..|..|.|     .|..:.|
  Fly   280 GRTASFVVSA-TKGCRNYLSCSDGVTVSERSC--GNYF---FDDQQGAC-----TPSVQTY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 13/73 (18%)
CBM_14 97..144 CDD:366726 13/66 (20%)
CBM_14 170..218 CDD:366726 15/48 (31%)
CG17145NP_001262098.1 CBM_14 91..142 CDD:279884 5/25 (20%)
CBM_14 278..327 CDD:279884 18/64 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444121
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.