DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG6933

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001262097.1 Gene:CG6933 / 40214 FlyBaseID:FBgn0036952 Length:363 Species:Drosophila melanogaster


Alignment Length:318 Identity:67/318 - (21%)
Similarity:100/318 - (31%) Gaps:113/318 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KFLVVFVALFGAAVAQSSFKCPDD-------FGFYPHDTSCDKYWKCDN-GVSELKTCGNGLAFD 59
            :..||...|..|  :|::....||       :|:..:.::|..:..|.| .|....||.|||.|:
  Fly    19 RICVVAACLLMA--SQATGYTMDDLCQQWSGYGYIGNPSNCHAWGYCKNQEVVAWGTCPNGLVFN 81

  Fly    60 ATDSKYLTENCDYLHNVDCG-DRTELEPPITTPHCSRLYGIFPDENKCDVFWNC-WNGEPSRYQC 122
            |.     ..:|||.:...|. ...|....:.:|    :|...|  ..|..:..| ..|:.|...|
  Fly    82 AQ-----AGSCDYANTTVCSTSAVETCSNVKSP----MYVANP--LNCTEYAYCDGTGQISYGDC 135

  Fly   123 SPGLAYDRDARVCMWADQVP------------------ECKNE-EVANGF--------------- 153
            ..|..|...:..|:|....|                  :|.|. ...||:               
  Fly   136 GTGGVYSASSTKCIWGPACPQDTICRFMLSNIFVGDPNQCGNYINCVNGYGTSEKCSSTANPYYN 200

  Fly   154 ----SC----PAAGELANAGSFSR------------------------------HAHPED---CR 177
                :|    |..||.:|:|:..:                              :.:..|   |.
  Fly   201 KATGNCQSTNPCTGEDSNSGNSDQFTVGQTNATACDEEAFKAADPLTVNGESVDYRYVSDGVTCY 265

  Fly   178 KYYICLEGVAREY--GCPIGTVFKIG----------DSDGTGNCEDP--EDVPGCEDY 221
            .||.|....|..|  .||.||.|..|          ..:..||..:|  .| .||::|
  Fly   266 GYYYCAAVNATGYWNQCPTGTQFNAGKCVSPASFVCTHNRCGNVNNPFMAD-EGCKNY 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 15/58 (26%)
CBM_14 97..144 CDD:366726 12/65 (18%)
CBM_14 170..218 CDD:366726 17/64 (27%)
CG6933NP_001262097.1 ChtBD2 44..90 CDD:214696 14/50 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444137
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.