Sequence 1: | NP_649611.2 | Gene: | Gasp / 40745 | FlyBaseID: | FBgn0026077 | Length: | 258 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001262094.1 | Gene: | CG6996 / 40212 | FlyBaseID: | FBgn0036950 | Length: | 364 | Species: | Drosophila melanogaster |
Alignment Length: | 247 | Identity: | 58/247 - (23%) |
---|---|---|---|
Similarity: | 96/247 - (38%) | Gaps: | 67/247 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 16 VAQSSFKC---------PDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCD 71
Fly 72 YLHNVDCGDRTELEPPITTPHCSRL-YGIF-PDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARV 134
Fly 135 -CMWADQVPEC---KNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLE----GVAREYG 191
Fly 192 -CPIGTVFKIGDSD----------------GTGN-----CEDPEDVPGCEDY 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gasp | NP_649611.2 | ChtBD2 | 21..72 | CDD:214696 | 15/59 (25%) |
CBM_14 | 97..144 | CDD:366726 | 13/48 (27%) | ||
CBM_14 | 170..218 | CDD:366726 | 14/73 (19%) | ||
CG6996 | NP_001262094.1 | CBM_14 | 29..73 | CDD:279884 | |
ChtBD2 | 85..130 | CDD:214696 | 12/51 (24%) | ||
CBM_14 | 146..196 | CDD:279884 | 14/50 (28%) | ||
CBM_14 | 273..322 | CDD:279884 | 7/24 (29%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45444122 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |