DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG6996

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001262094.1 Gene:CG6996 / 40212 FlyBaseID:FBgn0036950 Length:364 Species:Drosophila melanogaster


Alignment Length:247 Identity:58/247 - (23%)
Similarity:96/247 - (38%) Gaps:67/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 VAQSSFKC---------PDDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCD 71
            ::.||.||         |..|...|:  ||:.|:.|.:|......|..|:.|::.     |::| 
  Fly    74 LSSSSIKCLSSDPCAALPTGFAADPY--SCNGYYYCKDGKGTHGVCNTGMNFNSG-----TQDC- 130

  Fly    72 YLHNVDCGDRTELEPPITTPHCSRL-YGIF-PDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARV 134
             :.:..|.::  ::|   ..:|:.| .|:| .|.:.|:.:..||:|:.....| ||..|.:.:..
  Fly   131 -IRDFPCSNK--MDP---DSYCNILPDGVFVKDTDNCNGYQLCWDGQVINGTC-PGTFYFKASTA 188

  Fly   135 -CMWADQVPEC---KNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLE----GVAREYG 191
             |.:...| ||   ...:::....||..|     |..|.:   :.|..||.|.:    ..:.|:|
  Fly   189 QCDYPQNV-ECDFVPVPDISKKGVCPETG-----GFISDN---KTCNGYYYCKDLGNGEFSLEHG 244

  Fly   192 -CPIGTVFKIGDSD----------------GTGN-----CEDPEDVPGCEDY 221
             |..|..|...|..                |.||     ..:.:|  ||..|
  Fly   245 VCSDGRFFLATDGGACVPRSKVKCGYDRCVGLGNSTIQLANESDD--GCRGY 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 15/59 (25%)
CBM_14 97..144 CDD:366726 13/48 (27%)
CBM_14 170..218 CDD:366726 14/73 (19%)
CG6996NP_001262094.1 CBM_14 29..73 CDD:279884
ChtBD2 85..130 CDD:214696 12/51 (24%)
CBM_14 146..196 CDD:279884 14/50 (28%)
CBM_14 273..322 CDD:279884 7/24 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444122
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.