DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG7290

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001262093.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster


Alignment Length:285 Identity:58/285 - (20%)
Similarity:91/285 - (31%) Gaps:70/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 AAVAQSSFKCPDDF------------------GFY---PHDTSCDKYWKCDNGVSELKTCGNGLA 57
            |.|.::::.|.:..                  |||   |.|  |..:..|.:.|....:|.:||.
  Fly   134 ACVYKNNYPCSESAGDGSTVSVALNLCNLVKNGFYFGSPSD--CSGWNFCQDNVLHSGSCEDGLV 196

  Fly    58 FDATDSKYLTENCDYLHNVDCGDRTELEPPIT---TPHCSRLYGIFPDENKCDVFWNCWNGEPSR 119
            |:...|     ||.|.....|...|. :|.:|   .|......|.......|:.::.|..|....
  Fly   197 FNVQAS-----NCGYKMASSCAQVTN-DPSLTGVSAPTTCSSSGATIAATACNQYYLCSAGNYQL 255

  Fly   120 YQCSPGLAYDRDARVCMWADQVPECKNEEVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLE 184
            ..|..|..||..::.|:..   .|.:|:       |...  :....:|.......:|..|..|:.
  Fly   256 MTCPSGYYYDTISKACVTR---MEARND-------CDRC--VGTTATFVNAYSATNCSDYLYCVN 308

  Fly   185 GVAREY-GCPIGTVFKIGDSDGTGNCEDPEDVPGCEDYY----------------GDLDLKSIRK 232
            ||.:.. .||....|    ::..|:|     |.|.|..:                |.....|...
  Fly   309 GVQKAVESCPTNYYF----NENLGSC-----VNGLEPKFLCCNPTQSDGTSTSSSGSTSSGSTSS 364

  Fly   233 SELLAGLNSEGRTKGAPKTKAASSS 257
            ....:|..|.|.|.....:..::||
  Fly   365 GSTSSGSTSSGSTSSGSTSSGSTSS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 16/71 (23%)
CBM_14 97..144 CDD:366726 9/46 (20%)
CBM_14 170..218 CDD:366726 11/48 (23%)
CG7290NP_001262093.1 CBM_14 32..77 CDD:279884
CBM_14 91..142 CDD:279884 2/7 (29%)
CBM_14 160..207 CDD:279884 15/53 (28%)
CBM_14 234..277 CDD:279884 9/45 (20%)
ChtBD2 <296..331 CDD:214696 10/43 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444134
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.