DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG7298

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649187.3 Gene:CG7298 / 40210 FlyBaseID:FBgn0036948 Length:369 Species:Drosophila melanogaster


Alignment Length:195 Identity:50/195 - (25%)
Similarity:70/195 - (35%) Gaps:25/195 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 GFYPHDT-SCDKYWKCDNGVSEL-KTCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELEPPITT 90
            |.|..|| ||..:..|::..:.| ...|...|.:.|....|...|.|.....|...|.:......
  Fly   164 GQYFGDTESCSTWHYCESTSTGLVLQSGKCSANNQTAYNVLANQCTYESASVCSRVTNIPLSDAA 228

  Fly    91 PHCSRLYGIFPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNEEVANGFSC 155
            ..||.......|...|..::.|.||:.....|..|..||         |.:..|.:.:||.    
  Fly   229 VSCSTNGAKSADPKVCGTYYVCTNGKNVATYCPTGDYYD---------DSLGYCVSRQVAT---- 280

  Fly   156 PAAG----ELANAGSFSRHAHPEDCRKYYIC-LEGVAREYGCPIGTVFKIGDSDGTGNCEDPEDV 215
            |.||    :.|.: :|.......:|..||.| .:|.|....||..|.|   |....| |:..:|:
  Fly   281 PVAGCNRCQYATS-TFVNAVDSNNCSTYYYCNSQGEATLNTCPADTFF---DESRQG-CKSDDDL 340

  Fly   216  215
              Fly   341  340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 13/45 (29%)
CBM_14 97..144 CDD:366726 10/46 (22%)
CBM_14 170..218 CDD:366726 14/47 (30%)
CG7298NP_649187.3 ChtBD2 <239..274 CDD:214696 10/43 (23%)
ChtBD2 286..334 CDD:214696 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.