DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and obst-J

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_649179.2 Gene:obst-J / 40202 FlyBaseID:FBgn0036940 Length:353 Species:Drosophila melanogaster


Alignment Length:254 Identity:55/254 - (21%)
Similarity:84/254 - (33%) Gaps:69/254 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVFVALFGAAVAQSSFKC--PDDFGFYPHDTSCDKYWKC--DNGV--------------SELKT 51
            |.:..||..|.:...|..|  .|.:...||...|.:::.|  |:.:              .:|..
  Fly    12 LAIATALVKAELTDISAICRISDPWQMLPHKDHCQRFYVCTGDDDMPFQEFNCPAEYHFSKKLMI 76

  Fly    52 CGNGLAFD------ATDS------------------KYLTENCDYLHNVDCGDRTELEPPITTPH 92
            |..|...|      .|:|                  .:....|...:..|...|..|...|:..|
  Fly    77 CVPGACTDESVFCGLTNSVERVQSDCTRYRQCLEGGSFAVAKCSVGNYFDPARRACLPVAISAAH 141

  Fly    93 -CSRLYGIFPDE------NKCDVFWNCWNGEPSRYQCSPGLAYDR--------DARVCMWADQVP 142
             ||   .:.||.      :.|:.::.|.:|:....||..|..:|.        ...:|:....:|
  Fly   142 QCS---CVLPDNATLANPSDCETYFRCHSGQAELVQCPSGDYFDERVSSCVPDHTGICLEKPTMP 203

  Fly   143 ECKNEEVANGFSCPAAGELANAGSFSRHA-HPEDCRKYYICLEGVAREYGCPIGTVFKI 200
            ....|:......|...|        ||.| |..||::||||.:....|..||.|..|.:
  Fly   204 PTLTEQALAMDECIRTG--------SRLAPHSRDCQRYYICAKKRVLEMRCPRGQYFDV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 14/92 (15%)
CBM_14 97..144 CDD:366726 11/60 (18%)
CBM_14 170..218 CDD:366726 13/32 (41%)
obst-JNP_649179.2 ChtBD2 <40..79 CDD:214696 7/38 (18%)
CBM_14 145..192 CDD:279884 9/46 (20%)
CBM_14 216..259 CDD:279884 17/47 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444138
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.