DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and obst-H

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster


Alignment Length:278 Identity:60/278 - (21%)
Similarity:89/278 - (32%) Gaps:89/278 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKKFLV--VFVALFGAAVAQSSF-KCP--DDFGFYPHDTSCDKYWKCDNGVSELKTCGNGLAFDA 60
            |.|:|:  ..|.|:.:.:....| :|.  ||..|.....||..|..|:...|....|.:|..||:
  Fly     1 MSKYLIHLCLVLLWSSRINADHFDECDGMDDGAFVQSWESCQSYVYCEGEESLKGDCEDGEYFDS 65

  Fly    61 TDSKYLTENCDYLHNVDC--------------GDRTE---------LEPPIT-TPHCSRLYGIFP 101
            .     ...||...||.|              .|..|         .||||. ||....:..|.|
  Fly    66 E-----AGTCDIAANVSCFLDEVDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAP 125

  Fly   102 -------------------DENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPECKNE 147
                               ..|.|..::.|::|......|...|.::.....|.:.|:| :|..|
  Fly   126 VVRPNCPISDDPGQVIFMASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKV-QCAFE 189

  Fly   148 EVANGFSCPAAGELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIGDSDGTGNCEDP 212
            :..:....|...|.        ..||::|..:|.|::|......||.                  
  Fly   190 DPRSHKCLPHMTEF--------FPHPDNCNYFYYCIKGFLTLQQCPF------------------ 228

  Fly   213 EDVPGCEDYYG-DLDLKS 229
                    ||| |::.:|
  Fly   229 --------YYGWDIERRS 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 15/53 (28%)
CBM_14 97..144 CDD:366726 11/65 (17%)
CBM_14 170..218 CDD:366726 8/47 (17%)
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 16/55 (29%)
CBM_14 142..184 CDD:279884 8/41 (20%)
ChtBD2 203..240 CDD:214696 13/70 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.