DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG10725

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_648647.1 Gene:CG10725 / 39510 FlyBaseID:FBgn0036362 Length:269 Species:Drosophila melanogaster


Alignment Length:235 Identity:57/235 - (24%)
Similarity:84/235 - (35%) Gaps:71/235 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 KCPDDFGF--------------------------YPHDTSCDKYWKCDNGVSELKTCGNGLAFDA 60
            :||.|:.|                          :.:|.:|.||..|.:|...::.|.:||.::|
  Fly    57 ECPTDYYFDARDQECVPLMEVECIGSCKNRGLSSFCYDRTCTKYVLCFDGTPVIRQCSDGLQYNA 121

  Fly    61 TDSKYLTENCDYLHNVDCGDRTELEPPITTPHCSRLYG-----IFPDENKCDVFWNCWNGEPSRY 120
                 ||:.|||...|||.|..          |||...     ..|.:.:||.::.|.:|.|...
  Fly   122 -----LTDRCDYPQYVDC
VDNL----------CSRNNNPDDIVFIPSKARCDKYYICMDGLPQVQ 171

  Fly   121 QCSPGLAYDRDARVCMWADQVPECKNEEVANG-------------FSCPAAGELANAGSFSRHAH 172
            .|:.||.|:...:.|.:..:| .|..|.:...             ..||:.|     ..|..|..
  Fly   172 NCTSGLQYNPSTQSCDFPSKV
-NCTVESLQRNILPFARAPPRLADIECPSEG-----AHFIAHQK 230

  Fly   173 PEDCRKYYICLEGVAREYGCPIGTVFKIGDSDGTGNCEDP 212
            .:|.  ||.||.|......|..|.||.....:    |.:|
  Fly   231 RQDA--YYYCLNGRGVTLDCTPGLVFDAKREE----CREP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 17/75 (23%)
CBM_14 97..144 CDD:366726 12/51 (24%)
CBM_14 170..218 CDD:366726 13/43 (30%)
CG10725NP_648647.1 CBM_14 35..73 CDD:279884 4/15 (27%)
CBM_14 83..134 CDD:279884 16/55 (29%)
CBM_14 150..192 CDD:279884 11/41 (27%)
ChtBD2 216..264 CDD:214696 16/58 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444127
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.