DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG43896

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001261732.1 Gene:CG43896 / 39360 FlyBaseID:FBgn0264488 Length:2113 Species:Drosophila melanogaster


Alignment Length:231 Identity:59/231 - (25%)
Similarity:89/231 - (38%) Gaps:57/231 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELEPPITTPHC 93
            |..::.:|..|:.|.||.:.|:||..|..|:.:     ...|    .||.|:          ..|
  Fly   161 FVENEANCGSYYVCSNGEATLQTCPQGSFFNTS-----VAAC----TVDQGN----------SQC 206

  Fly    94 SRLYGI-------FPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPE--CKNEEV 149
            ...|.|       ..|::.|.:|:.|.|...:..:|..|..::.:...|:......|  |.:...
  Fly   207 WVNYCIGQDDGSAVADKSNCSLFYVCSNNTATAQECPEGSYFESNNWGCVPGTCTTESPCDDSTT 271

  Fly   150 ANGFSC-------PAA---GELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIG--- 201
            ....||       ||:   |::.||...   ...|:||||:||::||.....|..|.||...   
  Fly   272 TTTESCAEETTEPPASCDCGDIKNADFI---PDEENCRKYFICIDGVLVAADCGKGNVFNANLSV 333

  Fly   202 ---DSDGT---GNCEDPE---DVPGCEDYY----GD 224
               |:|.|   .:|.|.|   |...|..|:    ||
  Fly   334 CEVDADNTCCVADCTDGEAKVDPQDCTKYFKCQSGD 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 12/42 (29%)
CBM_14 97..144 CDD:366726 11/55 (20%)
CBM_14 170..218 CDD:366726 20/59 (34%)
CG43896NP_001261732.1 CBM_14 96..147 CDD:279884
CBM_14 153..206 CDD:279884 15/63 (24%)
CBM_14 211..257 CDD:279884 9/45 (20%)
CBM_14 298..343 CDD:279884 16/47 (34%)
CBM_14 354..395 CDD:279884 5/16 (31%)
CBM_14 427..468 CDD:279884
ChtBD2 488..535 CDD:214696
CBM_14 544..593 CDD:279884
CBM_14 <1320..1361 CDD:279884
ChtBD2 1627..1675 CDD:214696
CBM_14 1684..1733 CDD:279884
ChtBD2 1752..1797 CDD:214696
CBM_14 1820..1868 CDD:279884
CBM_14 1896..1939 CDD:279884
ChtBD2 2046..2091 CDD:214696
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443973
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23301
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.