Sequence 1: | NP_649611.2 | Gene: | Gasp / 40745 | FlyBaseID: | FBgn0026077 | Length: | 258 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261732.1 | Gene: | CG43896 / 39360 | FlyBaseID: | FBgn0264488 | Length: | 2113 | Species: | Drosophila melanogaster |
Alignment Length: | 231 | Identity: | 59/231 - (25%) |
---|---|---|---|
Similarity: | 89/231 - (38%) | Gaps: | 57/231 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 FYPHDTSCDKYWKCDNGVSELKTCGNGLAFDATDSKYLTENCDYLHNVDCGDRTELEPPITTPHC 93
Fly 94 SRLYGI-------FPDENKCDVFWNCWNGEPSRYQCSPGLAYDRDARVCMWADQVPE--CKNEEV 149
Fly 150 ANGFSC-------PAA---GELANAGSFSRHAHPEDCRKYYICLEGVAREYGCPIGTVFKIG--- 201
Fly 202 ---DSDGT---GNCEDPE---DVPGCEDYY----GD 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Gasp | NP_649611.2 | ChtBD2 | 21..72 | CDD:214696 | 12/42 (29%) |
CBM_14 | 97..144 | CDD:366726 | 11/55 (20%) | ||
CBM_14 | 170..218 | CDD:366726 | 20/59 (34%) | ||
CG43896 | NP_001261732.1 | CBM_14 | 96..147 | CDD:279884 | |
CBM_14 | 153..206 | CDD:279884 | 15/63 (24%) | ||
CBM_14 | 211..257 | CDD:279884 | 9/45 (20%) | ||
CBM_14 | 298..343 | CDD:279884 | 16/47 (34%) | ||
CBM_14 | 354..395 | CDD:279884 | 5/16 (31%) | ||
CBM_14 | 427..468 | CDD:279884 | |||
ChtBD2 | 488..535 | CDD:214696 | |||
CBM_14 | 544..593 | CDD:279884 | |||
CBM_14 | <1320..1361 | CDD:279884 | |||
ChtBD2 | 1627..1675 | CDD:214696 | |||
CBM_14 | 1684..1733 | CDD:279884 | |||
ChtBD2 | 1752..1797 | CDD:214696 | |||
CBM_14 | 1820..1868 | CDD:279884 | |||
CBM_14 | 1896..1939 | CDD:279884 | |||
ChtBD2 | 2046..2091 | CDD:214696 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45443973 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR23301 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.940 |