DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gasp and CG11570

DIOPT Version :9

Sequence 1:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster
Sequence 2:NP_001356902.1 Gene:CG11570 / 39357 FlyBaseID:FBgn0036230 Length:262 Species:Drosophila melanogaster


Alignment Length:166 Identity:36/166 - (21%)
Similarity:62/166 - (37%) Gaps:46/166 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVVFVALFG--------AAVAQSSFKCP--DDFGF-----YPHDTSCDKYWKCDNGVSELKTCGN 54
            |:.|:|:..        :.|...|.:||  ||...     ||:|  |.||:.|..|.:..:.|..
  Fly    12 LLAFIAIVDCQENNNLVSIVTDHSIQCPPFDDPNHNVMLPYPND--CSKYYVCQKGRAYEQQCPL 74

  Fly    55 GLAFDATDSKYLTENCDYLHNVDCGDRTELEPPITTPHCSRLYGIFPDENKCDVFWNCWNGEPSR 119
            .|.:     ..:|..|||....:|  .|.:..|               .:..:|.::.:.|:..|
  Fly    75 NLFW-----SQMTYRCDYKEYSNC--NTYIPSP---------------NHDVEVIFSAYPGDCRR 117

  Fly   120 Y------QCSPGLAYDRDARVCMWADQVPECKNEEV 149
            :      :|...|.:....:.|: ..|..:|:|..|
  Fly   118 FYETRILRCEQNLQWSSVYQRCV-VPQYGDCQNSPV 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GaspNP_649611.2 ChtBD2 21..72 CDD:214696 16/57 (28%)
CBM_14 97..144 CDD:366726 7/52 (13%)
CBM_14 170..218 CDD:366726
CG11570NP_001356902.1 CBM_14 51..93 CDD:307643 14/48 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.